Paralogue Annotation for ANK2 residue 708

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 708
Reference Amino Acid: V - Valine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 708

No paralogue variants have been mapped to residue 708 for ANK2.



ANK2VTLLLDKGANIHMSTKSGLTSLHLAAQEDK>V<NVADILTKHGADQDAHTKLGYTPLIVACHY738
ANK1VALLLSKQANGNLGNKSGLTPLHLVAQEGH>V<PVADVLIKHGVMVDATTRMGYTPLHVASHY711
ANK3VSLLLGRNANVNLSNKSGLTPLHLAAQEDR>V<NVAEVLVNQGAHVDAQTKMGYTPLHVGCHY740
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V708Mc.2122G>A Other Cardiac PhenotypeSIFT: deleterious
Polyphen: probably damaging
ReportsOther Cardiac Phenotype Association of torsades de pointes with novel and known single nucleotide polymorphisms in long QT syndrome genes. Am Heart J. 2006 152(6):1116-22. 17161064