Paralogue Annotation for ANK2 residue 743

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 743
Reference Amino Acid: M - Methionine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 743

No paralogue variants have been mapped to residue 743 for ANK2.



ANK2ILTKHGADQDAHTKLGYTPLIVACHYGNVK>M<VNFLLKQGANVNAKTKNGYTPLHQAAQQGH773
ANK1VLIKHGVMVDATTRMGYTPLHVASHYGNIK>L<VKFLLQHQADVNAKTKLGYSPLHQAAQQGH746
ANK3VLVNQGAHVDAQTKMGYTPLHVGCHYGNIK>I<VNFLLQHSAKVNAKTKNGYTPLHQAAQQGH775
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M743Tc.2228T>C Putative BenignSIFT:
Polyphen: probably damaging