Paralogue Annotation for ANK2 residue 750

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 750
Reference Amino Acid: Q - Glutamine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 750

No paralogue variants have been mapped to residue 750 for ANK2.



ANK2DQDAHTKLGYTPLIVACHYGNVKMVNFLLK>Q<GANVNAKTKNGYTPLHQAAQQGHTHIINVL780
ANK1MVDATTRMGYTPLHVASHYGNIKLVKFLLQ>H<QADVNAKTKLGYSPLHQAAQQGHTDIVTLL753
ANK3HVDAQTKMGYTPLHVGCHYGNIKIVNFLLQ>H<SAKVNAKTKNGYTPLHQAAQQGHTHIINVL782
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q750Rc.2249A>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging