Paralogue Annotation for ANK2 residue 784

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 784
Reference Amino Acid: G - Glycine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 784

No paralogue variants have been mapped to residue 784 for ANK2.



ANK2VNAKTKNGYTPLHQAAQQGHTHIINVLLQH>G<AKPNATTANGNTALAIAKRLGYISVVDTLK814
ANK1VNAKTKLGYSPLHQAAQQGHTDIVTLLLKN>G<ASPNEVSSDGTTPLAIAKRLGYISVTDVLK787
ANK3VNAKTKNGYTPLHQAAQQGHTHIINVLLQN>N<ASPNELTVNGNTALGIARRLGYISVVDTLK816
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G784Ec.2351G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging