Paralogue Annotation for ANK2 residue 790

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 790
Reference Amino Acid: T - Threonine
Protein Domain: Ankyrin domain region


Paralogue Variants mapped to ANK2 residue 790

No paralogue variants have been mapped to residue 790 for ANK2.



ANK2NGYTPLHQAAQQGHTHIINVLLQHGAKPNA>T<TANGNTALAIAKRLGYISVVDTLKVVTEEV820
ANK1LGYSPLHQAAQQGHTDIVTLLLKNGASPNE>V<SSDGTTPLAIAKRLGYISVTDVLKVVTDET793
ANK3NGYTPLHQAAQQGHTHIINVLLQNNASPNE>L<TVNGNTALGIARRLGYISVVDTLKIVTEET822
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T790Ic.2369C>T Putative BenignSIFT:
Polyphen: benign