Paralogue Annotation for ANK2 residue 851

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 851
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 851

No paralogue variants have been mapped to residue 851 for ANK2.



ANK2VLDVSDEE---------------------G>D<DTMTGDGGEYLRPEDLKELGDDSLPSSQFL881
ANK1ILDVSEDE---------------------G>E<ELISFKAERR-DS---RD------------836
ANK3VLDMSDDEVRKANAPEMLSDGEYISDVEEG>E<DAMTGDTDKYLGPQDLKELGDDSLPAEGYM903
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D851Yc.2551G>T Putative BenignSIFT: deleterious
Polyphen: probably damaging