Paralogue Annotation for ANK2 residue 879

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 879
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 879

No paralogue variants have been mapped to residue 879 for ANK2.



ANK2-GDDTMTGDGGEYLRPEDLKELGDDSLPSS>Q<FLDGMNYLRYSLEGGRSDSLRSFSSDRSHT909
ANK1-GEELISFKAERR-DS---RD--------->-<-------------VDEEKELLDFVPKLDQV853
ANK3EGEDAMTGDTDKYLGPQDLKELGDDSLPAE>G<YMG------FSL-GARSASLRSFSSDRSYT924
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q879Rc.2636A>G Putative BenignSIFT: tolerated
Polyphen: benign