Paralogue Annotation for ANK2 residue 882

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 882
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 882

No paralogue variants have been mapped to residue 882 for ANK2.



ANK2DTMTGDGGEYLRPEDLKELGDDSLPSSQFL>D<GMNYLRYSLEGGRSDSLRSFSSDRSHTLSH912
ANK1ELISFKAERR-DS---RD------------>-<----------VDEEKELLDFVPKLDQVVES856
ANK3DAMTGDTDKYLGPQDLKELGDDSLPAEGYM>G<------FSL-GARSASLRSFSSDRSYTLNR927
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D882Nc.2644G>A Putative BenignSIFT: deleterious
Polyphen: benign