Paralogue Annotation for ANK2 residue 893

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 893
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 893

No paralogue variants have been mapped to residue 893 for ANK2.



ANK2RPEDLKELGDDSLPSSQFLDGMNYLRYSLE>G<GRSDSLRSFSSDRSHTLSHASYLRDSAVMD923
ANK1DS---RD----------------------->V<DEEKELLDFVPKLDQVVESPAIPRIPCAMP867
ANK3GPQDLKELGDDSLPAEGYMG------FSL->G<ARSASLRSFSSDRSYTLNRSSYARDSMMIE938
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G893Ac.2678G>C Putative BenignSIFT: deleterious
Polyphen: benign