Paralogue Annotation for KCNE1 residue 28

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 28
Reference Amino Acid: S - Serine
Protein Domain: N-terminus


Paralogue Variants mapped to KCNE1 residue 28

No paralogue variants have been mapped to residue 28 for KCNE1.



KCNE1AVTPFLTKLWQE---T------VQQGGN-M>S<GLA-RRSPRSSDGKLEALYVLMVLGFFGFF57
KCNE2TLEDVFRRIFITYMDNW----RQNTTAEQE>A<LQA-KVDAENFY--YVILYLMVMIGMFSFI63
KCNE3SLHAVLKALNATLHSNLLCRPGPGLGPD-N>Q<TEERRASLPGR-DDNSYMYILFVMFLFAVT71
KCNE4-------MLKMEPLNST----HPGTAASSS>P<LES-RAAGGGSGNGNEYFYILVVMSFYGIF49
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S28Lc.83C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: possibly damaging
ReportsInherited ArrhythmiaLQTS Gene sequencing in neonates and infants with the long QT syndrome. Genet Test. 2005 9(4):281-4. 16379539
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS End-recovery QTc: a useful metric for assessing genetic variants of unknown significance in long-QT syndrome. J Cardiovasc Electrophysiol. 2012 23(6):637-42. doi: 10.1111/j.1540-8167.2011.02265. 22429796
Unknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510