Paralogue Annotation for KCNE1 residue 93

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 93
Reference Amino Acid: A - Alanine
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE1 residue 93

No paralogue variants have been mapped to residue 93 for KCNE1.



KCNE1SYIRSKKLEHSNDPFNVYIESDA-WQEKDK>A<YVQARVLESYRSCYVV--------------109
KCNE2STVKSKRREHSNDPYHQYIVED--WQEKYK>S<QILNL-------------------------103
KCNE3GYTRSRKVDKRSDPYHVYIKN--------->-<------------------------------98
KCNE4GYMKSKRREKKSSLLLLYKDEERLWGEAMK>P<LPVVSGLRSVQVPLMLNMLQESVAPALSCT116
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A93Tc.277G>A Inherited ArrhythmiaLQTSSIFT:
Polyphen:
ReportsInherited ArrhythmiaLQTS Mutations in Danish patients with long QT syndrome and the identification of a large founder family with p.F29L in KCNH2. BMC Med Genet. 2014 15:31. doi: 10.1186/1471-2350-15-31. 24606995