Paralogue Annotation for KCNE2 residue 40

Residue details

Gene: KCNE2
Reference Sequences: LRG: LRG_291, Ensembl variant: ENST00000290310 / ENSP00000290310
Amino Acid Position: 40
Reference Amino Acid: K - Lysine
Protein Domain: N-terminus


Paralogue Variants mapped to KCNE2 residue 40

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNE1R32HLong QT syndrome ?Medium3 10973849, 19716085
KCNE1R32CLong QT syndromeMedium3 23382499

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE2.



KCNE2FRRIFITYMDNW----RQNTTAEQEALQA->K<VDAENFY--YVILYLMVMIGMFSFIIVAIL68
KCNE1LTKLWQE---T------VQQGGN-MSGLA->R<RSPRSSDGKLEALYVLMVLGFFGFFTLGIM62
KCNE3LKALNATLHSNLLCRPGPGLGPD-NQTEER>R<ASLPGR-DDNSYMYILFVMFLFAVTVGSLI76
KCNE4--MLKMEPLNST----HPGTAASSSPLES->R<AAGGGSGNGNEYFYILVVMSFYGIFLIGIM54
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K40Rc.119A>G Putative BenignSIFT:
Polyphen: