No paralogue variants have been mapped to residue 101 for KCNH2.
| KCNH2 | --------GAEE-R-------KVE-IAFYR>K<-----------DGS---------------- | 104 |
| KCNH1 | --------NYEM-N-------SFE-ILMYK>K<-----------NRT---------------- | 105 |
| KCNH3 | --------EHKE-F-------KAE-LILYR>K<-----------SGL---------------- | 105 |
| KCNH4 | --------GHQE-H-------RAE-ICFYR>K<-----------DGS---------------- | 105 |
| KCNH5 | --------NYES-N-------CFE-VLLYK>K<-----------NRT---------------- | 103 |
| KCNH6 | --------GAEE-C-------KVD-ILYYR>K<-----------DAS---------------- | 104 |
| KCNH7 | --------GSEE-R-------KVE-VTYYH>K<-----------NGS---------------- | 104 |
| KCNH8 | --------EKTE-F-------KGE-IMFYK>K<-----------NGS---------------- | 105 |
| CNGA1 | --------EDDD-SASTSEESENEN-PHA->R<-----------GSF---------------- | 66 |
| CNGA2 | --------AADDDTSSE---------LQR->L<-----------ADV---------------- | 56 |
| CNGA3 | --------SSEE-TSSVLQPGIAME-TRG->L<-----------ADS---------------- | 60 |
| CNGA4 | ------------------------------>-<------------------------------ | |
| CNGB1 | --------AQDT-R-------PGLRLLLWL>E<QNLERVLPQPPKSSEVWRDEPAVATGAASD | 193 |
| CNGB3 | ------------------------------>-<------------------------------ | |
| HCN1 | TPPGGGGAGAKE-H-------GNS-VCFKV>D<------------------------------ | 62 |
| HCN2 | PQCSPAGPEGPA-R-------GPK-VSFSC>R<------------------------------ | 128 |
| HCN3 | --------------------------APPP>A<------------------------------ | 30 |
| HCN4 | ---------------------------ASC>E<------------------------------ | 180 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.K101E | c.301A>G | Inherited Arrhythmia | LQTS | rs199472856 | SIFT: deleterious Polyphen: benign |
| Reports | Inherited Arrhythmia | LQTS | Screening for mutations and polymorphisms in the genes KCNH2 and KCNE2 encoding the cardiac HERG/MiRP1 ion channel: implications for acquired and congenital long Q-T syndrome. Clin Chem. 2001 47(8):1390-5. 11468227 | ||
| Inherited Arrhythmia | LQTS | Automated mutation screening using dideoxy fingerprinting and capillary array electrophoresis. Hum Mutat. 2001 18(5):451-7. 11668638 | |||
| Other Cardiac Phenotype | Mutations in the HERG K+-ion channel: a novel link between long QT syndrome and sudden infant death syndrome. Am J Cardiol. 2005 95(3):433-4. 15670565 | ||||
| Inherited Arrhythmia | LQTS | Mutations in Danish patients with long QT syndrome and the identification of a large founder family with p.F29L in KCNH2. BMC Med Genet. 2014 15:31. doi: 10.1186/1471-2350-15-31. 24606995 | |||
| Inherited Arrhythmia | LQTS | Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810 | |||
| p.Lys101Asn | c.303A>T | Unknown | SIFT: Polyphen: | ||