No paralogue variants have been mapped to residue 108 for KCNH2.
| KCNH2 | ----DGS--------------------CFL>C<LVDVV------------------------- | 113 |
| KCNH1 | ----NRT--------------------PVW>F<FVKIA------------------------- | 114 |
| KCNH3 | ----SGL--------------------PFW>C<LLDVI------------------------- | 114 |
| KCNH4 | ----DGS--------------------AFW>C<LLDMM------------------------- | 114 |
| KCNH5 | ----NRT--------------------PVW>F<YMQIA------------------------- | 112 |
| KCNH6 | ----DAS--------------------SFR>C<LVDVV------------------------- | 113 |
| KCNH7 | ----NGS--------------------TFI>C<NTHII------------------------- | 113 |
| KCNH8 | ----NGS--------------------PFW>C<LLDIV------------------------- | 114 |
| CNGA1 | ----GSF--------------------SYK>S<LRKG-G------------------------ | 75 |
| CNGA2 | ----ADV--------------------D-A>P<QQGRSG------------------------ | 65 |
| CNGA3 | ----ADS--------------------GQG>S<FTGQ-G------------------------ | 69 |
| CNGA4 | ------------------------------>-<------------------------------ | |
| CNGB1 | PQPPKSSEVWRDEPAVATGAASDPAPPGRP>Q<EMGPKLQARETPSLPTPIPLQPKEEPKEAP | 231 |
| CNGB3 | ------------------------------>-<------------------------------ | |
| HCN1 | ------------------------------>-<------------------------------ | |
| HCN2 | ------------------------------>-<------------------------------ | |
| HCN3 | ------------------------------>-<------------------------------ | |
| HCN4 | ------------------------------>-<------------------------------ | |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.C108R | c.322T>C | Inherited Arrhythmia | LQTS | rs199472859 | SIFT: deleterious Polyphen: probably damaging |
| Reports | Inherited Arrhythmia | LQTS | Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085 | ||
| Inherited Arrhythmia | LQTS | Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810 | |||