No paralogue variants have been mapped to residue 109 for KCNH2.
| KCNH2 | ---DGS--------------------CFLC>L<VDVV-------------------------- | 113 |
| KCNH1 | ---NRT--------------------PVWF>F<VKIA-------------------------- | 114 |
| KCNH3 | ---SGL--------------------PFWC>L<LDVI-------------------------- | 114 |
| KCNH4 | ---DGS--------------------AFWC>L<LDMM-------------------------- | 114 |
| KCNH5 | ---NRT--------------------PVWF>Y<MQIA-------------------------- | 112 |
| KCNH6 | ---DAS--------------------SFRC>L<VDVV-------------------------- | 113 |
| KCNH7 | ---NGS--------------------TFIC>N<THII-------------------------- | 113 |
| KCNH8 | ---NGS--------------------PFWC>L<LDIV-------------------------- | 114 |
| CNGA1 | ---GSF--------------------SYKS>L<RKG-G------------------------- | 75 |
| CNGA2 | ---ADV--------------------D-AP>Q<QGRSG------------------------- | 65 |
| CNGA3 | ---ADS--------------------GQGS>F<TGQ-G------------------------- | 69 |
| CNGA4 | ------------------------------>-<------------------------------ | |
| CNGB1 | QPPKSSEVWRDEPAVATGAASDPAPPGRPQ>E<MGPKLQARETPSLPTPIPLQPKEEPKEAPA | 232 |
| CNGB3 | ------------------------------>-<------------------------------ | |
| HCN1 | ------------------------------>-<------------------------------ | |
| HCN2 | ------------------------------>-<------------------------------ | |
| HCN3 | ------------------------------>-<------------------------------ | |
| HCN4 | ------------------------------>-<------------------------------ | |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.L109P | c.326T>C | Inherited Arrhythmia | LQTS | SIFT: tolerated Polyphen: benign | |
| Reports | Inherited Arrhythmia | LQTS | The genetic basis of long QT and short QT syndromes: a mutation update. Hum Mutat. 2009 30(11):1486-511. 19862833 | ||
| Inherited Arrhythmia | LQTS | Mutations in Danish patients with long QT syndrome and the identification of a large founder family with p.F29L in KCNH2. BMC Med Genet. 2014 15:31. doi: 10.1186/1471-2350-15-31. 24606995 | |||
| p.L109R | c.326T>G | Putative Benign | rs199473498 | SIFT: tolerated Polyphen: benign | |