No paralogue variants have been mapped to residue 111 for KCNH2.
| KCNH2 | -DGS--------------------CFLCLV>D<VV---------------------------- | 113 |
| KCNH1 | -NRT--------------------PVWFFV>K<IA---------------------------- | 114 |
| KCNH3 | -SGL--------------------PFWCLL>D<VI---------------------------- | 114 |
| KCNH4 | -DGS--------------------AFWCLL>D<MM---------------------------- | 114 |
| KCNH5 | -NRT--------------------PVWFYM>Q<IA---------------------------- | 112 |
| KCNH6 | -DAS--------------------SFRCLV>D<VV---------------------------- | 113 |
| KCNH7 | -NGS--------------------TFICNT>H<II---------------------------- | 113 |
| KCNH8 | -NGS--------------------PFWCLL>D<IV---------------------------- | 114 |
| CNGA1 | -GSF--------------------SYKSLR>K<G-G--------------------------- | 75 |
| CNGA2 | -ADV--------------------D-APQQ>G<RSG--------------------------- | 65 |
| CNGA3 | -ADS--------------------GQGSFT>G<Q-G--------------------------- | 69 |
| CNGA4 | ------------------------------>-<------------------------------ | |
| CNGB1 | PKSSEVWRDEPAVATGAASDPAPPGRPQEM>G<PKLQARETPSLPTPIPLQPKEEPKEAPAPE | 234 |
| CNGB3 | ------------------------------>-<------------------------------ | |
| HCN1 | ------------------------------>-<------------------------------ | |
| HCN2 | ------------------------------>-<------------------------------ | |
| HCN3 | ------------------------------>-<------------------------------ | |
| HCN4 | ------------------------------>-<------------------------------ | |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.D111V | c.332A>T | Inherited Arrhythmia | LQTS | rs199472860 | SIFT: tolerated Polyphen: benign |
| Reports | Inherited Arrhythmia | LQTS | Mutation site dependent variability of cardiac events in Japanese LQT2 form of congenital long-QT syndrome. Circ J. 2008 72(5):694-9. 18441445 | ||
| Inherited Arrhythmia | LQTS | Atrioventricular block-induced Torsades de Pointes with clinical and molecular backgrounds similar to congenital long QT syndrome. Circ J. 2010 74(12):2562-71. 20975234 | |||