No paralogue variants have been mapped to residue 605 for KCNH2.
| KCNH2 | --------G------------------LGG>P<SIKDKYVTALYFTFSSLTSVGFGNVSPNTN | 635 |
| KCNH1 | ------GSG-----------S--GK-WEGG>P<SKNSVYISSLYFTMTSLTSVGFGNIAPSTD | 474 |
| KCNH3 | RPAGGNSSGQSDNCSSSSEANGTGLELLGG>P<SLRSAYITSLYFALSSLTSVGFGNVSANTD | 476 |
| KCNH4 | --------------------------SVGG>P<SRRSAYIAALYFTLSSLTSVGFGNVCANTD | 450 |
| KCNH5 | ------T-S-----------A--GI-WEGG>P<SKDSLYVSSLYFTMTSLTTIGFGNIAPTTD | 443 |
| KCNH6 | --------D-----------P------ASG>P<SVQDKYVTALYFTFSSLTSVGFGNVSPNTN | 487 |
| KCNH7 | --------D-----------S------SSG>P<SIKDKYVTALYFTFSSLTSVGFGNVSPNTN | 638 |
| KCNH8 | --------------------------TLGG>P<SIRSAYIAALYFTLSSLTSVGFGNVSANTD | 445 |
| CNGA1 | ----------------------------EF>G<RLARKYVYSLYWSTLTLTTIG-ETPPPVRD | 372 |
| CNGA2 | ----------------------------EY>G<YLAREYIYCLYWSTLTLTTIG-ETPPPVKD | 347 |
| CNGA3 | ----------------------------EH>G<RLSRKYIYSLYWSTLTLTTIG-ETPPPVKD | 375 |
| CNGA4 | ----------------------------GF>E<RLRRQYLYSFYFSTLILTTVG-DTPPPARE | 241 |
| CNGB1 | ------------------------------>-<GVGNSYIRCYYFAVKTLITIG-GLPDPKTL | 855 |
| CNGB3 | ------------------------------>-<GEGNEYLRCYYWAVRTLITIG-GLPEPQTL | 417 |
| HCN1 | ----------------------------VN>D<SWGKQYSYALFKAMSHMLCIGYGAQAPVSM | 369 |
| HCN2 | ----------------------------VN>H<SWSELYSFALFKAMSHMLCIGYGRQAPESM | 438 |
| HCN3 | ----------------------------VN>H<SWGRQYSHALFKAMSHMLCIGYGQQAPVGM | 322 |
| HCN4 | ----------------------------VN>N<SWGKQYSYALFKAMSHMLCIGYGRQAPVGM | 489 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.P605L | c.1814C>T | Inherited Arrhythmia | LQTS | rs199472938 | SIFT: deleterious Polyphen: probably damaging |
| Reports | Inherited Arrhythmia | LQTS | Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085 | ||
| Inherited Arrhythmia | LQTS | Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810 | |||
| p.P605S | c.1813C>T | Inherited Arrhythmia | LQTS | rs199472939 | SIFT: deleterious Polyphen: probably damaging |
| Reports | Inherited Arrhythmia | LQTS | Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085 | ||
| Inherited Arrhythmia | LQTS | Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810 | |||