Paralogue Annotation for KCNJ2 residue 300

Residue details

Gene: KCNJ2
Reference Sequences: LRG: LRG_328, Ensembl variant: ENST00000535240 / ENSP00000441848
Amino Acid Position: 300
Reference Amino Acid: G - Glycine
Protein Domain: C-terminus


Paralogue Variants mapped to KCNJ2 residue 300

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNJ11G289VHyperinsulinismHigh9 24401662

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNJ2.



KCNJ2HEIDEDSPLYDLSKQDID-NADFEIVVILE>G<MVEATAMTTQCRSSYLANEILWGHRYEPVL330
KCNJ1HVIDHNSPFFHMAAETLL-QQDFELVVFLD>G<TVESTSATCQVRTSYVPEEVLWGYRFAPIV329
KCNJ3HVIDAKSPFYDLSQRSMQ-TEQFEIVVILE>G<IVETTGMTCQARTSYTEDEVLWGHRFFPVI331
KCNJ4HEIDEDSPLYGMGKEELE-SEDFEIVVILE>G<MVEATAMTTQARSSYLASEILWGHRFEPVV322
KCNJ5HEINQKSPFWEMSQAQLH-QEEFEVVVILE>G<MVEATGMTCQARSSYMDTEVLWGHRFTPVL337
KCNJ6HEINQQSPFWEISKAQLP-KEELEIVVILE>G<MVEATGMTCQARSSYITSEILWGYRFTPVL340
KCNJ8HVIDKRSPLYDISATDLA-NQDLEVIVILE>G<VVETTGITTQARTSYIAEEIQWGHRFVSIV328
KCNJ9HEIDAASPFWEASRRALE-RDDFEIVVILE>G<MVEATGMTCQARSSYLVDEVLWGHRFTSVL308
KCNJ10HVVDETSPLKDLPLRSG--EGDFELVLILS>G<TVESTSATCQVRTSYLPEEILWGYEFTPAI315
KCNJ11HVIDANSPLYDLAPSDLHHHQDLEIIVILE>G<VVETTGITTQARTSYLADEILWGQRFVPIV319
KCNJ12HEIDEASPLFGISRQDLE-TDDFEIVVILE>G<MVEATAMTTQARSSYLANEILWGHRFEPVL331
KCNJ13HSITPSSPLATLLQHE-N-PSHFELVVFLS>A<MQEGTGEICQRRTSYLPSEIMLHHCFASLL303
KCNJ14HEIDSASPLYELGRAELA-RADFELVVILE>G<MVEATAMTTQCRSSYLPGELLWGHRFEPVL335
KCNJ15HVLDETSPLRDLTPQNLK-EKEFELVVLLN>A<TVESTSAVCQSRTSYIPEEIYWGFEFVPVV315
KCNJ16HEIDHESPLYALDRKAVA-KDNFEILVTFI>Y<TGDSTGTSHQSRSSYVPREILWGHRFNDVL314
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNJ2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G300Dc.899G>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS PIP2 binding residues of Kir2.1 are common targets of mutations causing Andersen syndrome. Neurology. 2003 60(11):1811-6. 12796536
Inherited ArrhythmiaLQTS In vivo and in vitro functional characterization of Andersen's syndrome mutations. J Physiol. 2005 565(Pt 3):731-41. 15831539
Inherited ArrhythmiaLQTS Andersen-Tawil syndrome: new potassium channel mutations and possible phenotypic variation. Neurology. 2005 65(7):1083-9. 16217063
p.G300Vc.899G>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Mutations in Kir2.1 cause the developmental and episodic electrical phenotypes of Andersen's syndrome. Cell. 2001 105(4):511-9. 11371347
Inherited ArrhythmiaLQTS Functional and clinical characterization of KCNJ2 mutations associated with LQT7 (Andersen syndrome). J Clin Invest. 2002 110(3):381-8. 12163457
Inherited ArrhythmiaLQTS Genotype-phenotype correlations of KCNJ2 mutations in Japanese patients with Andersen-Tawil syndrome. Hum Mutat. 2007 28(2):208. 17221872
Inherited ArrhythmiaLQTS Altered stress stimulation of inward rectifier potassium channels in Andersen-Tawil syndrome. FASEB J. 2012 26(2):513-22. 22002906
Inherited ArrhythmiaLQTS Andersen mutations of KCNJ2 suppress the native inward rectifier current IK1 in a dominant-negative fashion. Cardiovasc Res. 2003 59(2):321-7. 12909315
Inherited ArrhythmiaLQTS Defective potassium channel Kir2.1 trafficking underlies Andersen-Tawil syndrome. J Biol Chem. 2003 278(51):51779-85. 14522976
p.G300Ac.899G>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Unique post-exercise electrophysiological test results in a new Andersen-Tawil syndrome mutation. Clin Neurophysiol. 2011 122(12):2537-9. 21640645
Other Disease Phenotype Severe exacerbation of Andersen-Tawil syndrome secondary to thyrotoxicosis. J Hum Genet. 2014 59(8):465-6. doi: 10.1038/jhg.2014.43. 24849934