Paralogue Annotation for RYR1 residue 1015

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1015
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1015

No paralogue variants have been mapped to residue 1015 for RYR1.



RYR1DRLAENGHNVWARDRVGQGWSYSAVQDIPA>R<RNPRLVPYRLLDEATKRSNRDSLCQAVRTL1045
RYR2DKLAENAHNVWARDRIRQGWTYGIQQDVKN>R<RNPRLVPYTLLDDRTKKSNKDSLREAVRTL1057
RYR3DKLAENAHNVWAKDRIKQGWTYGIQQDLKN>K<RNPRLVPYALLDERTKKSNRDSLREAVRTF1044
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1015Cc.3043C>T Putative BenignSIFT:
Polyphen: probably damaging