Paralogue Annotation for RYR1 residue 1018

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1018
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1018

No paralogue variants have been mapped to residue 1018 for RYR1.



RYR1AENGHNVWARDRVGQGWSYSAVQDIPARRN>P<RLVPYRLLDEATKRSNRDSLCQAVRTLLGY1048
RYR2AENAHNVWARDRIRQGWTYGIQQDVKNRRN>P<RLVPYTLLDDRTKKSNKDSLREAVRTLLGY1060
RYR3AENAHNVWAKDRIKQGWTYGIQQDLKNKRN>P<RLVPYALLDERTKKSNRDSLREAVRTFVGY1047
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1018Ac.3052C>G Putative BenignSIFT:
Polyphen: probably damaging