Paralogue Annotation for RYR1 residue 1032

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1032
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1032

No paralogue variants have been mapped to residue 1032 for RYR1.



RYR1QGWSYSAVQDIPARRNPRLVPYRLLDEATK>R<SNRDSLCQAVRTLLGYGYNIEPPDQEP-SQ1061
RYR2QGWTYGIQQDVKNRRNPRLVPYTLLDDRTK>K<SNKDSLREAVRTLLGYGYNLEAPDQDHAAR1074
RYR3QGWTYGIQQDLKNKRNPRLVPYALLDERTK>K<SNRDSLREAVRTFVGYGYNIEPSDQEL-AD1060
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1032Hc.3095G>A Putative BenignSIFT:
Polyphen: probably damaging
p.R1032Cc.3094C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging