Paralogue Annotation for RYR1 residue 1071

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1071
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1071

No paralogue variants have been mapped to residue 1071 for RYR1.



RYR1RTLLGYGYNIEPPDQEP-SQVEN-QSRCDR>V<RIFRAEKSYTVQSGRWYFEFEAVTTGEMRV1101
RYR2RTLLGYGYNLEAPDQDHAARAEVCSGTGER>F<RIFRAEKTYAVKAGRWYFEFETVTAGDMRV1115
RYR3RTFVGYGYNIEPSDQEL-ADSAVEKVSIDK>I<RFFRVERSYAVRSGKWYFEFEVVTGGDMRV1101
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V1071Mc.3211G>A Putative BenignSIFT:
Polyphen: benign