Paralogue Annotation for RYR1 residue 1096

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1096
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1096

No paralogue variants have been mapped to residue 1096 for RYR1.



RYR1SRCDRVRIFRAEKSYTVQSGRWYFEFEAVT>T<GEMRVGWARPELRPDVELGADELAYVFNGH1126
RYR2GTGERFRIFRAEKTYAVKAGRWYFEFETVT>A<GDMRVGWSRPGCQPDQELGSDERAFAFDGF1140
RYR3VSIDKIRFFRVERSYAVRSGKWYFEFEVVT>G<GDMRVGWARPGCRPDVELGADDQAFVFEGN1126
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1096Ac.3286A>G Putative BenignSIFT:
Polyphen: possibly damaging