Paralogue Annotation for RYR1 residue 121

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 121
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 121

No paralogue variants have been mapped to residue 121 for RYR1.



RYR1SSQGGGHRTLLYGHAILLRHAHSRMYLSCL>T<TSRSMTDKLAFDVGLQEDATGEACWWTMHP151
RYR2TAQGGGHRTLLYGHAILLRHSYSGMYLCCL>S<TSRSSTDKLAFDVGLQEDTTGEACWWTIHP164
RYR3AAQGGGHRTLLYGHAVLLRHSFSGMYLTCL>T<TSRSQTDKLAFDVGLREHATGEACWWTIHP154
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T121Sc.362C>G Putative BenignSIFT: tolerated
Polyphen: probably damaging