Paralogue Annotation for RYR1 residue 1215

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1215
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1215

No paralogue variants have been mapped to residue 1215 for RYR1.



RYR1DGFLPVCSLGPGQVGHLNLGQDVSSLRFFA>I<CGLQEGFEPFAINMQRPVTTWFSKGLPQFE1245
RYR2DGFIPVCSLGVAQVGRMNFGKDVSTLKYFT>I<CGLQEGYEPFAVNTNRDITMWLSKRLPQFL1259
RYR3NGFVPICCLGLSQIGRMNLGTDASTFKFYT>M<CGLQEGFEPFAVNMNRDVAMWFSKRLPTFV1245
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I1215Tc.3644T>C Putative BenignSIFT:
Polyphen: benign