Paralogue Annotation for RYR1 residue 126

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 126
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 126

No paralogue variants have been mapped to residue 126 for RYR1.



RYR1GHRTLLYGHAILLRHAHSRMYLSCLTTSRS>M<TDKLAFDVGLQEDATGEACWWTMHPASKQR156
RYR2GHRTLLYGHAILLRHSYSGMYLCCLSTSRS>S<TDKLAFDVGLQEDTTGEACWWTIHPASKQR169
RYR3GHRTLLYGHAVLLRHSFSGMYLTCLTTSRS>Q<TDKLAFDVGLREHATGEACWWTIHPASKQR159
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M126Vc.376A>G Putative BenignSIFT:
Polyphen: benign