Paralogue Annotation for RYR1 residue 1265

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1265
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1265

No paralogue variants have been mapped to residue 1265 for RYR1.



RYR1TWFSKGLPQFEPVPLEHPHYEVSRVDGTVD>T<PPCLRLTHRTWGSQNSLVEMLFLRLSLPVQ1295
RYR2MWLSKRLPQFLQVPSNHEHIEVTRIDGTID>S<SPCLKVTQKSFGSQNSNTDIMFYRLSMPIE1309
RYR3MWFSKRLPTFVNVPKDHPHIEVMRIDGTMD>S<PPCLKVTHKTFGTQNSNADMIYCRLSMPVE1295
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1265Mc.3794C>T Putative BenignSIFT:
Polyphen: possibly damaging