Paralogue Annotation for RYR1 residue 1316

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1316
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1316

No paralogue variants have been mapped to residue 1316 for RYR1.



RYR1LFLRLSLPVQFHQHFRCTAGATPLAPPGLQ>P<PAEDEARAAEPDPDYENLRRSAGGWSEAEN1346
RYR2MFYRLSMPIECAEVFSKTV-AGGLPGAGLF>G<PK-NDLEDYDADSDFEVLMKTAHGHLVPDR1358
RYR3IYCRLSMPVECHSSFSH------------->-<------------------------------1302
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1316Tc.3946C>A Putative BenignSIFT:
Polyphen: benign