Paralogue Annotation for RYR1 residue 1360

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1360
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1360

No paralogue variants have been mapped to residue 1360 for RYR1.



RYR1DYENLRRSAGGWSEAENGKEGTAKEGAPGG>T<PQAGGEAQPARAENEKDATTEKNKKRGFLF1390
RYR2DFEVLMKTAHGHLVPDRVDKDKEATKPEFN>N<HK--------------DYAQEKP-SR--LK1385
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1360Pc.4078A>C Putative BenignSIFT: tolerated
Polyphen: benign