Paralogue Annotation for RYR1 residue 1361

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1361
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1361

No paralogue variants have been mapped to residue 1361 for RYR1.



RYR1YENLRRSAGGWSEAENGKEGTAKEGAPGGT>P<QAGGEAQPARAENEKDATTEKNKKRGFLFK1391
RYR2FEVLMKTAHGHLVPDRVDKDKEATKPEFNN>H<K--------------DYAQEKP-SR--LKQ1386
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1361Sc.4081C>T Putative BenignSIFT:
Polyphen: benign