Paralogue Annotation for RYR1 residue 1364

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1364
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1364

No paralogue variants have been mapped to residue 1364 for RYR1.



RYR1LRRSAGGWSEAENGKEGTAKEGAPGGTPQA>G<GEAQPARAENEKDATTEKNKKRGFLFKAKK1394
RYR2LMKTAHGHLVPDRVDKDKEATKPEFNNHK->-<------------DYAQEKP-SR--LKQRFL1389
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1364Wc.4090G>T Putative BenignSIFT:
Polyphen: probably damaging