Paralogue Annotation for RYR1 residue 1372

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1372
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1372

No paralogue variants have been mapped to residue 1372 for RYR1.



RYR1SEAENGKEGTAKEGAPGGTPQAGGEAQPAR>A<ENEKDATTEKNKKRGFLFKAKKVAMMTQPP1402
RYR2LVPDRVDKDKEATKPEFNNHK--------->-<----DYAQEKP-SR--LKQRFLLRRTKPDY1397
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A1372Vc.4115C>T Putative BenignSIFT: tolerated
Polyphen: benign