Paralogue Annotation for RYR1 residue 1423

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1423
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1423

No paralogue variants have been mapped to residue 1423 for RYR1.



RYR1KKVAMMTQPPATPTLPRLPHDVVPADNRDD>P<EIILNTTTYYYSVRVFAGQEPSCVWAGWVT1453
RYR2FLLRRTKPDYSTSHSARLTEDVLADDRDDY>D<FLMQT-STYYYSVRIFPGQEPANVWVGWIT1447
RYR3--------------SPCLDSEAFQKRKQMQ>E<ILSHTTTQCYYAIRIFAGQDPSCVWVGWVT1349
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1423Sc.4267C>T Putative BenignSIFT:
Polyphen: possibly damaging