Paralogue Annotation for RYR1 residue 1436

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1436
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1436

No paralogue variants have been mapped to residue 1436 for RYR1.



RYR1TLPRLPHDVVPADNRDDPEIILNTTTYYYS>V<RVFAGQEPSCVWAGWVTPDYHQHDMSFDLS1466
RYR2HSARLTEDVLADDRDDYDFLMQT-STYYYS>V<RIFPGQEPANVWVGWITSDFHQYDTGFDLD1460
RYR3-SPCLDSEAFQKRKQMQEILSHTTTQCYYA>I<RIFAGQDPSCVWVGWVTPDYHLYSEKFDLN1362
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V1436Mc.4306G>A Putative BenignSIFT:
Polyphen: probably damaging