Paralogue Annotation for RYR1 residue 1489

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1489
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1489

No paralogue variants have been mapped to residue 1489 for RYR1.



RYR1HDMSFDLSKVRVVTVTMGDEQGNVHSSLKC>S<NCYMVWGGDFVSPGQQGRISHTDLVIGCLV1519
RYR2YDTGFDLDRVRTVTVTLGDEKGKVHESIKR>S<NCYMVCAGESMSPGQ-G-RNNNGLEIGCVV1511
RYR3YSEKFDLNKNCTVTVTLGDERGRVHESVKR>S<NCYMVWGGDIVASSQRSNRSNVDLEIGCLV1415
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1489Nc.4466G>A Putative BenignSIFT:
Polyphen: probably damaging