Paralogue Annotation for RYR1 residue 1492

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1492
Reference Amino Acid: Y - Tyrosine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1492

No paralogue variants have been mapped to residue 1492 for RYR1.



RYR1SFDLSKVRVVTVTMGDEQGNVHSSLKCSNC>Y<MVWGGDFVSPGQQGRISHTDLVIGCLVDLA1522
RYR2GFDLDRVRTVTVTLGDEKGKVHESIKRSNC>Y<MVCAGESMSPGQ-G-RNNNGLEIGCVVDAA1514
RYR3KFDLNKNCTVTVTLGDERGRVHESVKRSNC>Y<MVWGGDIVASSQRSNRSNVDLEIGCLVDLA1418
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y1492Cc.4475A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging