Paralogue Annotation for RYR1 residue 1497

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1497
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1497

No paralogue variants have been mapped to residue 1497 for RYR1.



RYR1KVRVVTVTMGDEQGNVHSSLKCSNCYMVWG>G<DFVSPGQQGRISHTDLVIGCLVDLATGLMT1527
RYR2RVRTVTVTLGDEKGKVHESIKRSNCYMVCA>G<ESMSPGQ-G-RNNNGLEIGCVVDAASGLLT1519
RYR3KNCTVTVTLGDERGRVHESVKRSNCYMVWG>G<DIVASSQRSNRSNVDLEIGCLVDLAMGMLS1423
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1497Rc.4489G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging