Paralogue Annotation for RYR1 residue 1499

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1499
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1499

No paralogue variants have been mapped to residue 1499 for RYR1.



RYR1RVVTVTMGDEQGNVHSSLKCSNCYMVWGGD>F<VSPGQQGRISHTDLVIGCLVDLATGLMTFT1529
RYR2RTVTVTLGDEKGKVHESIKRSNCYMVCAGE>S<MSPGQ-G-RNNNGLEIGCVVDAASGLLTFI1521
RYR3CTVTVTLGDERGRVHESVKRSNCYMVWGGD>I<VASSQRSNRSNVDLEIGCLVDLAMGMLSFS1425
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F1499Sc.4496T>C Putative BenignSIFT: tolerated
Polyphen: probably damaging