Paralogue Annotation for RYR1 residue 1582

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1582
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1582

No paralogue variants have been mapped to residue 1582 for RYR1.



RYR1FVLPTHQNVIQFELGKQKNIMPLSAAMFQS>E<RKNPAPQCPPRLEMQMLMPVSWSRMPNHFL1612
RYR2FAQATSPNVFQFELGRIKNVMPLSAGLFKS>E<HKNPVPQCPPRLHVQFLSHVLWSRMPNQFL1604
RYR3FLQPTSTSLFQFELGKLKNAMPLSAAIFRS>E<EKNPVPQCPPRLDVQTIQPVLWSRMPNSFL1508
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1582Kc.4744G>A Putative BenignSIFT:
Polyphen: probably damaging