Paralogue Annotation for RYR1 residue 1592

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1592
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1592

No paralogue variants have been mapped to residue 1592 for RYR1.



RYR1QFELGKQKNIMPLSAAMFQSERKNPAPQCP>P<RLEMQMLMPVSWSRMPNHFLQVETRRAGER1622
RYR2QFELGRIKNVMPLSAGLFKSEHKNPVPQCP>P<RLHVQFLSHVLWSRMPNQFLKVDVSRISER1614
RYR3QFELGKLKNAMPLSAAIFRSEEKNPVPQCP>P<RLDVQTIQPVLWSRMPNSFLKVETERVSER1518
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1592Lc.4775C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943