Paralogue Annotation for RYR1 residue 1637

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1637
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1637

No paralogue variants have been mapped to residue 1637 for RYR1.



RYR1MPNHFLQVETRRAGERLGWAVQCQEPLTMM>A<LHIPEENRCMDILELSERLDLQRFHSHTLR1667
RYR2MPNQFLKVDVSRISERQGWLVQCLDPLQFM>S<LHIPEENRSVDILELTEQEELLKFHYHTLR1659
RYR3MPNSFLKVETERVSERHGWVVQCLEPLQMM>A<LHIPEENRCVDILELCEQEDLMRFHYHTLR1563
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A1637Vc.4910C>T Putative BenignSIFT: tolerated
Polyphen: probably damaging