Paralogue Annotation for RYR1 residue 1660

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1660
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1660

No paralogue variants have been mapped to residue 1660 for RYR1.



RYR1QEPLTMMALHIPEENRCMDILELSERLDLQ>R<FHSHTLRLYRAVCALGNNRVAHALCSHVDQ1690
RYR2LDPLQFMSLHIPEENRSVDILELTEQEELL>K<FHYHTLRLYSAVCALGNHRVAHALCSHVDE1682
RYR3LEPLQMMALHIPEENRCVDILELCEQEDLM>R<FHYHTLRLYSAVCALGNSRVAYALCSHVDL1586
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1660Pc.4979G>C Putative Benignrs200625526SIFT:
Polyphen: possibly damaging