Paralogue Annotation for RYR1 residue 1667

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1667
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1667

No paralogue variants have been mapped to residue 1667 for RYR1.



RYR1ALHIPEENRCMDILELSERLDLQRFHSHTL>R<LYRAVCALGNNRVAHALCSHVDQAQLLHAL1697
RYR2SLHIPEENRSVDILELTEQEELLKFHYHTL>R<LYSAVCALGNHRVAHALCSHVDEPQLLYAI1689
RYR3ALHIPEENRCVDILELCEQEDLMRFHYHTL>R<LYSAVCALGNSRVAYALCSHVDLSQLFYAI1593
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1667Cc.4999C>T BenignSIFT:
Polyphen: benign
p.R1667Hc.5000G>A Putative BenignSIFT:
Polyphen: benign