Paralogue Annotation for RYR1 residue 1917

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1917
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1917

No paralogue variants have been mapped to residue 1917 for RYR1.



RYR1EDEEEKEEDEEETAQEKEDEEKEEEEAAEG>E<KEEGLEEGLLQMKLPESVKLQMCHLLEYFC1947
RYR2E-K---ELS----VDDAK-LQGAGEE--EA>K<GGKRPKEGLLQMKLPEPVKLQMCLLLQYLC1914
RYR3E-E---VTQ----VEEKA-VEAG-----EK>A<GKEAPVKGLLQTRLPESVKLQMCELLSYLC1815
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1917Gc.5750A>G Putative BenignSIFT:
Polyphen: benign