Paralogue Annotation for RYR1 residue 199

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 199
Reference Amino Acid: W - Tryptophan
Protein Domain:


Paralogue Variants mapped to RYR1 residue 199

No paralogue variants have been mapped to residue 199 for RYR1.



RYR1ILVSVSSERYLHLSTASGELQVDASFMQTL>W<NMNPICSR--CEEGFVTGGHVLRLFHGHMD227
RYR2ILVSVSSERYLHLSYGNGSLHVDAAFQQTL>W<SVAPISSGSEAAQGYLIGGDVLRLLHGHMD242
RYR3ILVSVSSERYLHLSVSNGNIQVDASFMQTL>W<NVHPTCSGSSIEEGYLLGGHVVRLFHGH-D231
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.W199Rc.595T>C Putative BenignSIFT:
Polyphen: probably damaging