Paralogue Annotation for RYR1 residue 1994

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 1994
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 1994

No paralogue variants have been mapped to residue 1994 for RYR1.



RYR1RYVDKLQANQRSRYGLLIKAFSMTAAETAR>R<TREFRSPPQEQINMLLQFKDGTDEEDCPLP2024
RYR2DFVAKLQDNQRFRYNEVMQALNMSAALTAR>K<TKEFRSPPQEQINMLLNFKD--DKSECPCP1989
RYR3IYVSKLQANQKFRYNELMQALNMSAALTAR>K<TKEFRSPPQEQINMLLNFQL--GE-NCPCP1889
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1994Cc.5980C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging
p.R1994Hc.5981G>A Putative BenignSIFT: deleterious
Polyphen: benign