Paralogue Annotation for RYR1 residue 2084

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2084
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2084

No paralogue variants have been mapped to residue 2084 for RYR1.



RYR1EEETTLGSRLMSLLEKVRLVKKKEEKPEEE>R<SAEESKPRSLQELVSHMVVRWAQEDFVQSP2114
RYR2NSDLTIRGRLLSLVEKVTYLKKKQA--EKP>V<ESDSKKSSTLQQLISETMVRWAQESVIEDP2078
RYR3EEDTSWTGKLCALVYKIKGPPKPEK--EQP>T<EEEERCPTTLKELISQTMICWAQEDQIQDS1976
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2084Qc.6251G>A Putative BenignSIFT:
Polyphen: benign