Paralogue Annotation for RYR1 residue 215
Residue details
Gene: RYR1Reference Sequences: Ensembl variant:
ENST00000359596 /
ENSP00000352608Amino Acid Position: 215
Reference Amino Acid: G - Glycine
Protein Domain: Paralogue Variants mapped to RYR1 residue 215
| Paralogue | Variant | Associated Disease | Mapping Quality | Consensus | Pubmed | | RYR2 | G230C | Catecholaminergic polymorphic ventricular tachycar | High | 9 |
21659649, 23746327, 24025405 |
To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to
check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing.
It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.
| RYR1 | ELQVDASFMQTLWNMNPICSR--CEEGFVT>G<GHVLRLFHGHMDECLTISPAD-SDDQRRLV | 244 |
| RYR2 | SLHVDAAFQQTLWSVAPISSGSEAAQGYLI>G<GDVLRLLHGHMDECLTVPSGEHGEEQRRTV | 260 |
| RYR3 | NIQVDASFMQTLWNVHPTCSGSSIEEGYLL>G<GHVVRLFHGH-DECLTIPSTDQNDSQHRRI | 249 |
| cons | > < | |
Known Variants in RYR1
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|
| p.G215E | c.644G>A |
Other Myopathy | | rs118192115 | SIFT: Polyphen: |
| Reports | Other Myopathy | |
Dominant and recessive central core disease associated with RYR1 mutations and fetal akinesia. Brain. 2003 126(Pt 11):2341-9.
12937085 |
| Other Myopathy | |
Disease mutations in the ryanodine receptor N-terminal region couple to a mobile intersubunit interface. Nat Commun. 2013 4:1506. doi: 10.1038/ncomms2501.
23422674 |
| Unknown | |
Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180.
22009146 |
| Other Disease Phenotype | |
Mutations in CNTNAP1 and ADCY6 are responsible for severe arthrogryposis multiplex congenita with axoglial defects. Hum Mol Genet. 2014 23(9):2279-89. doi: 10.1093/hmg/ddt618.
24319099 |