Paralogue Annotation for RYR1 residue 2224

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2224
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2224

No paralogue variants have been mapped to residue 2224 for RYR1.



RYR1HPNLMRALGMHETVMEVMVNVLGGGESKEI>R<FPKMVTSCCRFLCYFCRISRQNQRSMFDHL2254
RYR2HPNLMRALGMHETVMEVMVNVLGGGESKEI>T<FPKMVANCCRFLCYFCRISRQNQKAMFDHL2218
RYR3HPNLMRVLGMHETVMEVMVNVLGT-EKSQI>A<FPKMVASCCRFLCYFCRISRQNQKAMFEHL2115
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2224Cc.6670C>T Putative BenignSIFT:
Polyphen: probably damaging
p.R2224Hc.6671G>A Putative BenignSIFT: tolerated
Polyphen: benign