Paralogue Annotation for RYR1 residue 2253

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2253
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2253

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2H2217YCatecholaminergic polymorphic ventricular tachycarHigh7 19398665, 24025405

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1IRFPKMVTSCCRFLCYFCRISRQNQRSMFD>H<LSYLLENSGIG--L-GMQGSTPLDVAAASV2280
RYR2ITFPKMVANCCRFLCYFCRISRQNQKAMFD>H<LSYLLENSSVGLASPAMRGSTPLDVAAASV2247
RYR3IAFPKMVASCCRFLCYFCRISRQNQKAMFE>H<LSYLLENSSVGLASPSMRGSTPLDVAASSV2144
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H2253Yc.6757C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Screening of the ryanodine 1 gene for malignant hyperthermia causative mutations by high resolution melt curve analysis. Anesth Analg. 2011 113(5):1120-8. 21965348